General Information

  • ID:  hor005284
  • Uniprot ID:  P06304
  • Protein name:  Pancreatic hormone
  • Gene name:  PPY
  • Organism:  Anser anser anser (Western greylag goose)
  • Family:  NPY family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Anser anser (species), Anser (genus), Anserinae (subfamily), Anatidae (family), Anseriformes (order), Galloanserae (superorder), Neognathae (infraclass), Aves (class), Coelurosauria, Theropoda, Saurischia, Dinosauria, Archosauria, Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GPSQPTYPGNDAPVEDLRFYYDNLQQYRLNVFRHRY
  • Length:  36(1-36)
  • Propeptide:  GPSQPTYPGNDAPVEDLRFYYDNLQQYRLNVFRHRY
  • Signal peptide:  NA
  • Modification:  T36 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Acts as a regulator of pancreatic and gastrointestinal functions
  • Mechanism:  NA
  • Cross BBB:  NO
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P06304-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-P06304-F1.pdbhor005284_AF2.pdbhor005284_ESM.pdb

Physical Information

Mass: 501525 Formula: C199H286N56O58
Absent amino acids: CIKMW Common amino acids: Y
pI: 7.52 Basic residues: 5
Polar residues: 12 Hydrophobic residues: 8
Hydrophobicity: -122.78 Boman Index: -10803
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 51.39
Instability Index: 7817.22 Extinction Coefficient cystines: 7450
Absorbance 280nm: 212.86

Literature

  • PubMed ID:  6484562
  • Title:  Isolation and sequence determination of goose pancreatic polypeptide.
  • PubMed ID:  6745282
  • Title:   Conformational studies on the pancreatic polypeptide hormone family.